pGP704 sequence
LOCUS       nuc 1        3705 bp    DNA   circular  BCT       15-FEB-1998

DEFINITION  pGP704.
ACCESSION   nuc 1
KEYWORDS    .
SOURCE      Escherichia coli.
  ORGANISM  Escherichia coli
            Eubacteria; Proteobacteria; gamma subdivision; 
Enterobacteriaceae;
            Escherichia.
REFERENCE   1  (bases 1 to 3705)
  AUTHORS   Edwards,R.A.
  TITLE     The sequence of pGP704
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3705)
  AUTHORS   Edwards,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-1998) Department of Microbiology, 
University of
            Illinois at Urbana Champaign, 601 S. Goodwin Ave, Urbana, Il 
61801,
            USA
FEATURES             Location/Qualifiers
     source          1..3705
                     /organism="Escherichia coli"
                     /plasmid=""
     misc_feature    1..436
                     /note="oriV from M65025"
                     /function="replication origin"
     rep_origin      1..436
                     /standard_name="oriV"
     misc_feature    complement(437..2164)
                     /standard_name="oriT"
                     /note="oriT from L27758"
                     /function="transfer origin"
     gene            <2162..>2346
                     /note="tetracycline resistance"
                     /gene="tet"
     CDS             <2162..>2346
                     /gene="tet"
                     /codon_start=1
                     /evidence=not_experimental
                     /transl_table=11
                     
/translation="ILYAGRIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFG
                     VGMVAGPVAGGLLGAIS"
     misc_feature    2165..3632
                     /partial
                     /standard_name="pBR322"
                     /note="pBR322 sequence from J01749"
     gene            complement(2638..3498)
                     /gene="bla"
     CDS             complement(2638..3498)
                     /gene="bla"
                     /codon_start=1
                     /product="beta-lactamase"
                     /transl_table=11
                     
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     
IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     
YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     
DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     
LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW"
     misc_feature    3633..3705
                     /standard_name="multiple cloning site"
                     /note="mcs from L08833"
BASE COUNT      814 a   1015 c   1024 g    852 t
ORIGIN
        1 gatcgctagt ttgttttgac tccatccatt agggcttcta aaacgccttc 
taaggccatg
       61 tcagccgtta agtgttcctg tgtcactgaa aattgctttg agaggctcta 
agggcttctc
      121 agtgcgttac atccctggct tgttgtccac aaccgttaaa ccttaaaagc 
tttaaaagcc
      181 ttatatattc ttttttttct tataaaactt aaaaccttag aggctattta 
agttgctgat
      241 ttatattaat tttattgttc aaacatgaga gcttagtacg tgaaacatga 
gagcttagta
      301 cgttagccat gagagcttag tacgttagcc atgagggttt agttcgttaa 
acatgagagc
      361 ttagtacgtt aaacatgaga gcttagtacg tgaaacatga gagcttagta 
cgtactatca
      421 acaggttgaa ctgctggatc ctttttgtcc ggtgttgggt tgaaggtgaa 
gccggtcggg
      481 gccgcagcgg gggccggctt ttcagccttg cccccctgct tcggccgccg 
tggctccggc
      541 gtcttgggtg ccggcgcggg ttccgcagcc ttggcctgcg gtgcgggcac 
atcggcgggc
      601 ttggccttga tgtgccgcct ggcgtgcgag cggaacgtct cgtaggagaa 
cttgaccttc
      661 cccgtttccc gcatgtgctc ccaaatggtg acgagcgcat agccggacgc 
taacgccgcc
      721 tcgacatccg ccctcaccgc caggaacgca accgcagcct catcacgccg 
gcgcttcttg
      781 gccgcgcggg attcaaccca ctcggccagc tcgtcggtgt agctctttgg 
catcgtctct
      841 cgcctgtccc ctcagttcag taatttcctg catttgcctg tttccagtcg 
gtagatattc
      901 cacaaaacag cagggaagca gcgcttttcc gctgcataac cctgcttcgg 
ggtcattata
      961 gcgatttttt cggtatatcc atcctttttc gcacgatata caggattttg 
ccaaagggtt
     1021 cgtgtagact ttccttggtg tatccaacgg cgtcagccgg gcaggatagg 
tgaagtaggc
     1081 ccacccgcga gcgggtgttc cttcttcact gtcccttatt cgcacctggc 
ggtgctcaac
     1141 gggaatcctg ctctgcgagg ctggccggct accgccggcg taacagatga 
gggcaagcgg
     1201 atggctgatg aaaccaagcc aaccaggaag ggcagcccac ctatcaaggt 
gtactgcctt
     1261 ccagacgaac gaagagcgat tgaggaaaag gcggcggcgg ccggcatgag 
cctgtcggcc
     1321 tacctgctgg ccgtcggcca gggctacaaa atcacgggcg tcgtggacta 
tgagcacgtc
     1381 cgcgagctgg cccgcatcaa tggcgacctg ggccgcctgg gcggcctgct 
gaaactctgg
     1441 ctcaccgacg acccgcgcac ggcgcggttc ggtgatgcca cgatcctcgc 
cctgctggcg
     1501 aagatcgaag agaagcagga cgagcttggc aaggtcatga tgggcgtggt 
ccgcccgagg
     1561 gcagagccat gactttttta gccgctaaaa cggccggggg gtgcgcgtga 
ttgccaagca
     1621 cgtccccatg cgctccatca agaagagcga cttcgcggag ctggtgaagt 
acatcaccga
     1681 cgagcaaggc aagaccgagc gcctgggtca cgtgcgcgtc acgaactgcg 
aggcaaacac
     1741 cctgcccgct gtcatggccg aggtgatggc gacccagcac ggcaacaccc 
gttccgaggc
     1801 cgacaagacc tatcacctgc tggttagctt ccgcgcggga gagaagcccg 
acgcggagac
     1861 gttgcgcgcg attgaggacc gcatctgcgc tgggcttggc ttcgccgagc 
atcagcgcgt
     1921 cagtgccgtg catcacgaca ccgacaacct gcacatccat atcgccatca 
acaagattca
     1981 cccgacccga aacaccatcc atgagccgta tcgggcctac cgcgccctcg 
ctgacctctg
     2041 cgcgacgctc gaacgggact acgggcttga gcgtgacaat cacgaaacgc 
ggcagcgcgt
     2101 ttccgagaac cgcgcgaacg acatggagcg gcacgcgggc gtggaaagcc 
tggtcggctg
     2161 gatcctctac gccggacgca tcgtggccgg catcaccggc gccacaggtg 
cggttgctgg
     2221 cgcctatatc gccgacatca ccgatgggga agatcgggct cgccacttcg 
ggctcatgag
     2281 cgcttgtttc ggcgtgggta tggtggcagg ccccgtggcc gggggactgt 
tgggcgccat
     2341 ctccttgctg cctcgcgcgt ttcggtgatg acggtgaaaa cctctgacac 
atgcagctcc
     2401 cggagacggt cacagcttgt ctgtaagcgg atgccgggag cagacaagcc 
cgtcagggcg
     2461 cgtcagcggg tgttggcggg tgtcggggcg cagccatgac ccagtcacgt 
agcgatagcg
     2521 gagtgtatac tggcttaact atgcggcatc agagcagatt gtactgagag 
tgcaccaaaa
     2581 ttaaaaatga agttttaaat caatctaaag tatatatgag taaacttggt 
ctgacagtta
     2641 ccaatgctta atcagtgagg cacctatctc agcgatctgt ctatttcgtt 
catccatagt
     2701 tgcctgactc cccgtcgtgt agataactac gatacgggag ggcttaccat 
ctggccccag
     2761 tgctgcaatg ataccgcgag acccacgctc accggctcca gatttatcag 
caataaacca
     2821 gccagccgga agggccgagc gcagaagtgg tcctgcaact ttatccgcct 
ccatccagtc
     2881 tattaattgt tgccgggaag ctagagtaag tagttcgcca gttaatagtt 
tgcgcaacgt
     2941 tgttgccatt gctgcaggca tcgtggtgtc acgctcgtcg tttggtatgg 
cttcattcag
     3001 ctccggttcc caacgatcaa ggcgagttac atgatccccc atgttgtgca 
aaaaagcggt
     3061 tagctccttc ggtcctccga tcgttgtcag aagtaagttg gccgcagtgt 
tatcactcat
     3121 ggttatggca gcactgcata attctcttac tgtcatgcca tccgtaagat 
gcttttctgt
     3181 gactggtgag tactcaacca agtcattctg agaatagtgt atgcggcgac 
cgagttgctc
     3241 ttgcccggcg tcaacacggg ataataccgc gccacatagc agaactttaa 
aagtgctcat
     3301 cattggaaaa cgttcttcgg ggcgaaaact ctcaaggatc ttaccgctgt 
tgagatccag
     3361 ttcgatgtaa cccactcgtg cacccaactg atcttcagca tcttttactt 
tcaccagcgt
     3421 ttctgggtga gcaaaaacag gaaggcaaaa tgccgcaaaa aagggaataa 
gggcgacacg
     3481 gaaatgttga atactcatac tcttcctttt tcaatattat tgaagcattt 
atcagggtta
     3541 ttgtctcatg agcggataca tatttgaatg tatttagaaa aataaacaaa 
taggggttcc
     3601 gcgcacattt ccccgaaaag tgccacctgc agatctgcag gtcgacggat 
cccaagcttc
     3661 ttctagaggt accgcatgcg atatcgagct ctcccgggaa ttc
//